CDS

Accession Number TCMCG024C64186
gbkey CDS
Protein Id XP_035835277.1
Location complement(join(40477651..40477782,40477895..40477945,40478090..40478287,40479147..40479203))
Gene LOC110890081
GeneID 110890081
Organism Helianthus annuus

Protein

Length 145aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA396063
db_source XM_035979384.1
Definition FACT complex subunit SSRP1 [Helianthus annuus]

EGGNOG-MAPPER Annotation

COG_category BKL
Description Component of the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. During transcription elongation the FACT complex acts as a histone chaperone that both destabilizes and restores nucleosomal structure. It facilitates the passage of RNA polymerase II and transcription by promoting the dissociation of one histone H2A-H2B dimer from the nucleosome, then subsequently promotes the reestablishment of the nucleosome following the passage of RNA polymerase II
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko03000        [VIEW IN KEGG]
KEGG_ko ko:K09272        [VIEW IN KEGG]
EC -
KEGG_Pathway -
GOs GO:0000003        [VIEW IN EMBL-EBI]
GO:0000228        [VIEW IN EMBL-EBI]
GO:0000741        [VIEW IN EMBL-EBI]
GO:0000785        [VIEW IN EMBL-EBI]
GO:0000790        [VIEW IN EMBL-EBI]
GO:0000791        [VIEW IN EMBL-EBI]
GO:0003006        [VIEW IN EMBL-EBI]
GO:0003674        [VIEW IN EMBL-EBI]
GO:0003700        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005634        [VIEW IN EMBL-EBI]
GO:0005654        [VIEW IN EMBL-EBI]
GO:0005694        [VIEW IN EMBL-EBI]
GO:0005719        [VIEW IN EMBL-EBI]
GO:0006355        [VIEW IN EMBL-EBI]
GO:0006996        [VIEW IN EMBL-EBI]
GO:0006997        [VIEW IN EMBL-EBI]
GO:0007275        [VIEW IN EMBL-EBI]
GO:0008023        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0009553        [VIEW IN EMBL-EBI]
GO:0009559        [VIEW IN EMBL-EBI]
GO:0009561        [VIEW IN EMBL-EBI]
GO:0009791        [VIEW IN EMBL-EBI]
GO:0009889        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0010197        [VIEW IN EMBL-EBI]
GO:0010228        [VIEW IN EMBL-EBI]
GO:0010468        [VIEW IN EMBL-EBI]
GO:0010556        [VIEW IN EMBL-EBI]
GO:0016043        [VIEW IN EMBL-EBI]
GO:0019219        [VIEW IN EMBL-EBI]
GO:0019222        [VIEW IN EMBL-EBI]
GO:0022414        [VIEW IN EMBL-EBI]
GO:0030154        [VIEW IN EMBL-EBI]
GO:0031323        [VIEW IN EMBL-EBI]
GO:0031326        [VIEW IN EMBL-EBI]
GO:0031974        [VIEW IN EMBL-EBI]
GO:0031981        [VIEW IN EMBL-EBI]
GO:0032501        [VIEW IN EMBL-EBI]
GO:0032502        [VIEW IN EMBL-EBI]
GO:0032991        [VIEW IN EMBL-EBI]
GO:0035101        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043228        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043232        [VIEW IN EMBL-EBI]
GO:0043233        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044427        [VIEW IN EMBL-EBI]
GO:0044428        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044451        [VIEW IN EMBL-EBI]
GO:0044454        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0048229        [VIEW IN EMBL-EBI]
GO:0048284        [VIEW IN EMBL-EBI]
GO:0048608        [VIEW IN EMBL-EBI]
GO:0048731        [VIEW IN EMBL-EBI]
GO:0048856        [VIEW IN EMBL-EBI]
GO:0048869        [VIEW IN EMBL-EBI]
GO:0050789        [VIEW IN EMBL-EBI]
GO:0050794        [VIEW IN EMBL-EBI]
GO:0051171        [VIEW IN EMBL-EBI]
GO:0051252        [VIEW IN EMBL-EBI]
GO:0060255        [VIEW IN EMBL-EBI]
GO:0061458        [VIEW IN EMBL-EBI]
GO:0065007        [VIEW IN EMBL-EBI]
GO:0070013        [VIEW IN EMBL-EBI]
GO:0071840        [VIEW IN EMBL-EBI]
GO:0080090        [VIEW IN EMBL-EBI]
GO:0140110        [VIEW IN EMBL-EBI]
GO:1903506        [VIEW IN EMBL-EBI]
GO:2000112        [VIEW IN EMBL-EBI]
GO:2001141        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGAATGAAGATCTTTTCGCTACCAAATACAAGGACAAGCTAGAACCAACTTATAAGGGACTGATTTATGAAGTGTTTACAATGGTATTGAGAGGCTTATCAGGCACAAAACTCACAAGTCCCGGAAAATTCCGTAGCTGTCAAGACGGTTACGCTGTGAAGTCATCGTTAAAAGCCGAAGATGGCGTTCTTTATCCGCTTGAAAAGAGCTTTTTCTTCTTACCAAAACCACCTAGTCTTATTCTATACGATGAGATGGCAAAATATTCCAAGTGCAAGCTGGAATTCAGCAAGTGTCAAAGGAAGGATATAGGGTATGTTTGGCAAAAGTATTTGGTCGCAAAAGAAGAGTTCGGTGATGAAGAGGTGAACTGTGAATCTTCACCGGAACAGGCTGCAAATTTTTTATTTTGGTTTCGCTCGATCCACTTTAGATGA
Protein:  
MNEDLFATKYKDKLEPTYKGLIYEVFTMVLRGLSGTKLTSPGKFRSCQDGYAVKSSLKAEDGVLYPLEKSFFFLPKPPSLILYDEMAKYSKCKLEFSKCQRKDIGYVWQKYLVAKEEFGDEEVNCESSPEQAANFLFWFRSIHFR